Lineage for d1q0la3 (1q0l A:126-274)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962012Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2962013Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)
  7. 2962014Species Escherichia coli [TaxId:562] [69771] (11 PDB entries)
    Uniprot P45568
  8. 2962035Domain d1q0la3: 1q0l A:126-274 [104457]
    Other proteins in same PDB: d1q0la1, d1q0la2
    complexed with fom, ndp
    has additional insertions and/or extensions that are not grouped together

Details for d1q0la3

PDB Entry: 1q0l (more details), 2.65 Å

PDB Description: crystal structure of dxr in complex with fosmidomycin
PDB Compounds: (A:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1q0la3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0la3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasq
mevlihpqsvihsmvryqdgsvlaqlgep

SCOPe Domain Coordinates for d1q0la3:

Click to download the PDB-style file with coordinates for d1q0la3.
(The format of our PDB-style files is described here.)

Timeline for d1q0la3: