SCOP 1.71: Domain d1q0la2: 1q0l A:1-125,A:275-300

Lineage for d1q0la2 (1q0l A:1-125,A:275-300)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)

7. Species Escherichia coli [TaxId:562] [69411] (10 PDB entries)

8. Domain d1q0la2: 1q0l A:1-125,A:275-300 [104456]
   Other proteins in same PDB: d1q0la1, d1q0la3
   complexed with fom, ndp

Details for d1q0la2

PDB Entry: 1q0l, 2.65 Å

PDB Description: crystal structure of dxr in complex with fosmidomycin

SCOP Domain Sequences for d1q0la2:

Sequence; same for both SEQRES and ATOM records:

>d1q0la2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc

Timeline for d1q0la2:

• d1q0la2 first appeared in SCOP 1.69
  
• d1q0la2 appears in SCOP 1.73
  
• d1q0la2 appears in the current release, SCOPe 2.08