Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species) |
Species Escherichia coli [TaxId:562] [69411] (10 PDB entries) |
Domain d1q0la2: 1q0l A:1-125,A:275-300 [104456] Other proteins in same PDB: d1q0la1, d1q0la3 complexed with fom, ndp |
PDB Entry: 1q0l (more details), 2.65 Å
SCOP Domain Sequences for d1q0la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q0la2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli} mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti llankXdmrtpiahtmawpnrvnsgvkpldfc
Timeline for d1q0la2: