Lineage for d1q0la1 (1q0l A:301-398)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445008Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 445107Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) (S)
  5. 445108Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)
  6. 445109Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)
  7. 445110Species Escherichia coli [TaxId:562] [69058] (10 PDB entries)
  8. 445129Domain d1q0la1: 1q0l A:301-398 [104455]
    Other proteins in same PDB: d1q0la2, d1q0la3

Details for d1q0la1

PDB Entry: 1q0l (more details), 2.65 Å

PDB Description: crystal structure of dxr in complex with fosmidomycin

SCOP Domain Sequences for d1q0la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0la1 a.69.3.1 (A:301-398) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli}
klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
lsvlekmdmrepqcvddvlsvdanarevarkevmrlas

SCOP Domain Coordinates for d1q0la1:

Click to download the PDB-style file with coordinates for d1q0la1.
(The format of our PDB-style files is described here.)

Timeline for d1q0la1: