SCOP 1.71: Domain d1q0kk_: 1q0k K:

Lineage for d1q0kk_ (1q0k K:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family)

5. Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (1 protein)

6. Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)

7. Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries)

8. Domain d1q0kk_: 1q0k K: [104453]

Details for d1q0kk_

PDB Entry: 1q0k, 2.1 Å

PDB Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the thiosulfate-reduced state

SCOP Domain Sequences for d1q0kk_:

Sequence; same for both SEQRES and ATOM records:

>d1q0kk_ a.24.22.1 (K:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis}
hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka

Timeline for d1q0kk_:

• d1q0kk_ first appeared in SCOP 1.69
  
• d1q0kk_ appears in SCOP 1.73
  
• d1q0kk_ appears in the current release, SCOPe 2.08