Lineage for d1q0kk_ (1q0k K:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440553Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 440973Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
  5. 440974Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (1 protein)
  6. 440975Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 440995Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries)
  8. 441048Domain d1q0kk_: 1q0k K: [104453]

Details for d1q0kk_

PDB Entry: 1q0k (more details), 2.1 Å

PDB Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the thiosulfate-reduced state

SCOP Domain Sequences for d1q0kk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0kk_ a.24.22.1 (K:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis}
hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka

SCOP Domain Coordinates for d1q0kk_:

Click to download the PDB-style file with coordinates for d1q0kk_.
(The format of our PDB-style files is described here.)

Timeline for d1q0kk_: