Lineage for d1q0kj_ (1q0k J:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1727408Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
    automatically mapped to Pfam PF09055
  5. 1727409Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins)
  6. 1727410Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 1727430Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries)
    Uniprot P80734
  8. 1727482Domain d1q0kj_: 1q0k J: [104452]
    complexed with ni, so4, thj

Details for d1q0kj_

PDB Entry: 1q0k (more details), 2.1 Å

PDB Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the thiosulfate-reduced state
PDB Compounds: (J:) Superoxide dismutase [Ni]

SCOPe Domain Sequences for d1q0kj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0kj_ a.24.22.1 (J:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis [TaxId: 73044]}
hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka

SCOPe Domain Coordinates for d1q0kj_:

Click to download the PDB-style file with coordinates for d1q0kj_.
(The format of our PDB-style files is described here.)

Timeline for d1q0kj_: