Lineage for d1q0kc_ (1q0k C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638393Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
  5. 638394Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (1 protein)
  6. 638395Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 638415Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries)
  8. 638460Domain d1q0kc_: 1q0k C: [104445]

Details for d1q0kc_

PDB Entry: 1q0k (more details), 2.1 Å

PDB Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the thiosulfate-reduced state
PDB Compounds: (C:) Superoxide dismutase [Ni]

SCOP Domain Sequences for d1q0kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0kc_ a.24.22.1 (C:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis [TaxId: 73044]}
hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka

SCOP Domain Coordinates for d1q0kc_:

Click to download the PDB-style file with coordinates for d1q0kc_.
(The format of our PDB-style files is described here.)

Timeline for d1q0kc_: