Lineage for d1q0ha2 (1q0h A:1-125,A:275-300)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575085Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 575086Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 575087Species Escherichia coli [TaxId:562] [69411] (10 PDB entries)
  8. 575088Domain d1q0ha2: 1q0h A:1-125,A:275-300 [104441]
    Other proteins in same PDB: d1q0ha1, d1q0ha3
    complexed with cit, fom, ndp

Details for d1q0ha2

PDB Entry: 1q0h (more details), 2.2 Å

PDB Description: crystal structure of selenomethionine-labelled dxr in complex with fosmidomycin

SCOP Domain Sequences for d1q0ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0ha2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc

SCOP Domain Coordinates for d1q0ha2:

Click to download the PDB-style file with coordinates for d1q0ha2.
(The format of our PDB-style files is described here.)

Timeline for d1q0ha2: