Lineage for d1q0fd_ (1q0f D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535478Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 535915Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
  5. 535916Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (1 protein)
  6. 535917Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 535937Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries)
  8. 535959Domain d1q0fd_: 1q0f D: [104419]

Details for d1q0fd_

PDB Entry: 1q0f (more details), 2.2 Å

PDB Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the state after partial x-ray-induced reduction

SCOP Domain Sequences for d1q0fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0fd_ a.24.22.1 (D:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis}
hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka

SCOP Domain Coordinates for d1q0fd_:

Click to download the PDB-style file with coordinates for d1q0fd_.
(The format of our PDB-style files is described here.)

Timeline for d1q0fd_: