SCOPe 2.08: Domain d1q04a_: 1q04 A:

Lineage for d1q04a_ (1q04 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1q04a_: 1q04 A: [104402]
   complexed with fmt

Details for d1q04a_

PDB Entry: 1q04, 1.8 Å

PDB Description: crystal structure of fgf-1, s50e/v51n

PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d1q04a_:

Sequence; same for both SEQRES and ATOM records:

>d1q04a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaeengevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
ckrgprthygqkailflplpv

Timeline for d1q04a_:

• d1q04a_ first appeared in SCOP 1.69
  
• d1q04a_ appears in SCOPe 2.07