Lineage for d1q03a_ (1q03 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791607Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2791608Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 2791622Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 2791723Domain d1q03a_: 1q03 A: [104400]
    mutant

Details for d1q03a_

PDB Entry: 1q03 (more details), 2.05 Å

PDB Description: crystal structure of fgf-1, s50g/v51g mutant
PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d1q03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q03a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaegggevyik
stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
krgprthygqkailflplpvs

SCOPe Domain Coordinates for d1q03a_:

Click to download the PDB-style file with coordinates for d1q03a_.
(The format of our PDB-style files is described here.)

Timeline for d1q03a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q03b_