Lineage for d1pzzb_ (1pzz B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464259Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 464260Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 464261Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 464275Species Human (Homo sapiens) [TaxId:9606] [50359] (26 PDB entries)
  8. 464299Domain d1pzzb_: 1pzz B: [104399]

Details for d1pzzb_

PDB Entry: 1pzz (more details), 2 Å

PDB Description: crystal structure of fgf-1, v51n mutant

SCOP Domain Sequences for d1pzzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzzb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens)}
hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesngevy
ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
sckrgprthygqkailflplpv

SCOP Domain Coordinates for d1pzzb_:

Click to download the PDB-style file with coordinates for d1pzzb_.
(The format of our PDB-style files is described here.)

Timeline for d1pzzb_: