![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110065] (1 PDB entry) Uniprot P96278 |
![]() | Domain d1pzsa_: 1pzs A: [104397] complexed with cu |
PDB Entry: 1pzs (more details), 1.63 Å
SCOPe Domain Sequences for d1pzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} qsltstltapdgtkvatakfefangyatvtiattgvgkltpgfhglhihqvgkcepnsva ptggapgnflsagghyhvpghtgtpasgdlaslqvrgdgsamlvtttdaftmddllsgak taiiihagadnfanipperyvqvngtpgpdettlttgdagkrvacgvigsg
Timeline for d1pzsa_: