SCOPe 2.06: Domain d1pzmb_: 1pzm B:

Lineage for d1pzmb_ (1pzm B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species)

7. Species Leishmania tarentolae [TaxId:5689] [110658] (1 PDB entry)
   Uniprot Q9NJI5

8. Domain d1pzmb_: 1pzm B: [104396]
   complexed with 5gp

Details for d1pzmb_

PDB Entry: 1pzm, 2.1 Å

PDB Description: Crystal structure of HGPRT-ase from Leishmania tarentolae in complex with GMP

PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1pzmb_:

Sequence, based on SEQRES records:

>d1pzmb_ c.61.1.1 (B:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]}
ypmsartlvtqeqvwaatakcakkiaadykdfhltadnplyllcvlkgsfiftadlarfl
adegvpvkveficassygsgvetsgqvrmlldvrdsvenrhimlvedivdsaitlqylmr
fmlakkpaslktvvlldkpsgrkvdvlvdypvitiprafvigygmdfaesyrelrdicvl
kk

Sequence, based on observed residues (ATOM records):

>d1pzmb_ c.61.1.1 (B:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]}
ypmsartlvtqeqvwaatakcakkiaadykdfhltadnplyllcvlkgsfiftadlarfl
adegvpvkveficavrmlldvrdsvenrhimlvedivdsaitlqylmrfmlakkpaslkt
vvlldkpsgrkvdvlvdypvitiprafvigygmdfaesyrelrdicvlkk

Timeline for d1pzmb_:

• d1pzmb_ first appeared in SCOP 1.69
  
• d1pzmb_ appears in SCOPe 2.05
  
• d1pzmb_ appears in SCOPe 2.07
  
• d1pzmb_ appears in the current release, SCOPe 2.08