Lineage for d1pylb_ (1pyl B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2531111Protein Ribonuclease Sa2 [110767] (1 species)
  7. 2531112Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries)
    Uniprot Q53752
  8. 2531114Domain d1pylb_: 1pyl B: [104392]
    complexed with so4

Details for d1pylb_

PDB Entry: 1pyl (more details), 1.51 Å

PDB Description: Crystal structure of Ribonuclease Sa2
PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d1pylb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pylb_ d.1.1.2 (B:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]}
aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg
sndrgtrrvvtggygeqywspdhyatfqeidprc

SCOPe Domain Coordinates for d1pylb_:

Click to download the PDB-style file with coordinates for d1pylb_.
(The format of our PDB-style files is described here.)

Timeline for d1pylb_: