SCOPe 2.07: Domain d1pylb_: 1pyl B:

Lineage for d1pylb_ (1pyl B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Ribonuclease Sa2 [110767] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries)
   Uniprot Q53752

8. Domain d1pylb_: 1pyl B: [104392]
   complexed with so4

Details for d1pylb_

PDB Entry: 1pyl, 1.51 Å

PDB Description: Crystal structure of Ribonuclease Sa2

PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d1pylb_:

Sequence; same for both SEQRES and ATOM records:

>d1pylb_ d.1.1.2 (B:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]}
aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg
sndrgtrrvvtggygeqywspdhyatfqeidprc

Timeline for d1pylb_:

• d1pylb_ first appeared in SCOP 1.69
  
• d1pylb_ appears in SCOPe 2.06
  
• d1pylb_ appears in the current release, SCOPe 2.08