Lineage for d1pyla_ (1pyl A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 849710Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 849711Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 849712Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 849849Protein Ribonuclease Sa2 [110767] (1 species)
  7. 849850Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries)
    Uniprot Q53752
  8. 849851Domain d1pyla_: 1pyl A: [104391]

Details for d1pyla_

PDB Entry: 1pyl (more details), 1.51 Å

PDB Description: Crystal structure of Ribonuclease Sa2
PDB Compounds: (A:) Ribonuclease

SCOP Domain Sequences for d1pyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyla_ d.1.1.2 (A:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]}
dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
pgsndrgtrrvvtggygeqywspdhyatfqeidprc

SCOP Domain Coordinates for d1pyla_:

Click to download the PDB-style file with coordinates for d1pyla_.
(The format of our PDB-style files is described here.)

Timeline for d1pyla_: