Lineage for d1py5a_ (1py5 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512504Protein Type I TGF-beta receptor R4 [56144] (1 species)
    TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 512505Species Human (Homo sapiens) [TaxId:9606] [56145] (4 PDB entries)
  8. 512507Domain d1py5a_: 1py5 A: [104389]

Details for d1py5a_

PDB Entry: 1py5 (more details), 2.3 Å

PDB Description: Crystal Structure of TGF-beta receptor I kinase with inhibitor
PDB Compounds: (A:)

SCOP Domain Sequences for d1py5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1py5a_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens)}
tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqe
g

SCOP Domain Coordinates for d1py5a_:

Click to download the PDB-style file with coordinates for d1py5a_.
(The format of our PDB-style files is described here.)

Timeline for d1py5a_: