Lineage for d1py3c_ (1py3 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595668Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 595669Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 595670Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 595781Protein Ribonuclease Sa2 [110767] (1 species)
  7. 595782Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries)
  8. 595787Domain d1py3c_: 1py3 C: [104388]
    complexed with so4

Details for d1py3c_

PDB Entry: 1py3 (more details), 1.8 Å

PDB Description: Crystal structure of Ribonuclease Sa2

SCOP Domain Sequences for d1py3c_:

Sequence, based on SEQRES records: (download)

>d1py3c_ d.1.1.2 (C:) Ribonuclease Sa2 {Streptomyces aureofaciens}
dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
pgsndrgtrrvvtggygeqywspdhyatfqeidprc

Sequence, based on observed residues (ATOM records): (download)

>d1py3c_ d.1.1.2 (C:) Ribonuclease Sa2 {Streptomyces aureofaciens}
dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
prgtrrvvtggygeqywspdhyatfqeidprc

SCOP Domain Coordinates for d1py3c_:

Click to download the PDB-style file with coordinates for d1py3c_.
(The format of our PDB-style files is described here.)

Timeline for d1py3c_: