Lineage for d1py3c_ (1py3 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923941Protein Ribonuclease Sa2 [110767] (1 species)
  7. 2923942Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries)
    Uniprot Q53752
  8. 2923947Domain d1py3c_: 1py3 C: [104388]
    complexed with so4

Details for d1py3c_

PDB Entry: 1py3 (more details), 1.8 Å

PDB Description: Crystal structure of Ribonuclease Sa2
PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d1py3c_:

Sequence, based on SEQRES records: (download)

>d1py3c_ d.1.1.2 (C:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]}
dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
pgsndrgtrrvvtggygeqywspdhyatfqeidprc

Sequence, based on observed residues (ATOM records): (download)

>d1py3c_ d.1.1.2 (C:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]}
dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
prgtrrvvtggygeqywspdhyatfqeidprc

SCOPe Domain Coordinates for d1py3c_:

Click to download the PDB-style file with coordinates for d1py3c_.
(The format of our PDB-style files is described here.)

Timeline for d1py3c_: