SCOPe 2.04: Domain d1py3a_: 1py3 A:

Lineage for d1py3a_ (1py3 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Ribonuclease Sa2 [110767] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries)
   Uniprot Q53752

8. Domain d1py3a_: 1py3 A: [104386]
   complexed with so4

Details for d1py3a_

PDB Entry: 1py3, 1.8 Å

PDB Description: Crystal structure of Ribonuclease Sa2

PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d1py3a_:

Sequence; same for both SEQRES and ATOM records:

>d1py3a_ d.1.1.2 (A:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]}
aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg
sndrgtrrvvtggygeqywspdhyatfqeidprc

Timeline for d1py3a_:

• d1py3a_ first appeared in SCOP 1.69
  
• d1py3a_ appears in SCOPe 2.03
  
• d1py3a_ appears in SCOPe 2.05
  
• d1py3a_ appears in the current release, SCOPe 2.08