Lineage for d1py3a_ (1py3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923941Protein Ribonuclease Sa2 [110767] (1 species)
  7. 2923942Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries)
    Uniprot Q53752
  8. 2923945Domain d1py3a_: 1py3 A: [104386]
    complexed with so4

Details for d1py3a_

PDB Entry: 1py3 (more details), 1.8 Å

PDB Description: Crystal structure of Ribonuclease Sa2
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d1py3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1py3a_ d.1.1.2 (A:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]}
aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg
sndrgtrrvvtggygeqywspdhyatfqeidprc

SCOPe Domain Coordinates for d1py3a_:

Click to download the PDB-style file with coordinates for d1py3a_.
(The format of our PDB-style files is described here.)

Timeline for d1py3a_: