Lineage for d1pxya_ (1pxy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995978Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1995979Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1995980Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 protein domains)
    Pfam PF00307
  6. 1996008Protein Fimbrin (Plastin), actin-crosslinking domain [47580] (3 species)
    duplication: tandem repeat of four CH domains
  7. 1996015Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109827] (1 PDB entry)
    Uniprot Q7G188 123-623
  8. 1996016Domain d1pxya_: 1pxy A: [104384]

Details for d1pxya_

PDB Entry: 1pxy (more details), 2.4 Å

PDB Description: Crystal structure of the actin-crosslinking core of Arabidopsis fimbrin
PDB Compounds: (A:) fimbrin-like protein

SCOPe Domain Sequences for d1pxya_:

Sequence, based on SEQRES records: (download)

>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sekgpfvqhinrylgddpflkqflpldphsnqlyelvkdgvllcklinvavpgtiderai
ntkrvlnpwernenhtlclnsakavgcsvvnigtqdlaegrphlvlglisqlikiqllad
lnlkktpqlvelledsddveellrlppekvllkwmnfhlkkggykktvsnfsadlkdaqa
yafllnvlapehcdpatldakdpleraelvlshaermnckryltaeeivegsstlnlafv
aqifhernglnkdgkyafaemmtedvetcrdercyrlwinslgidsyvnnvfedvrngwi
llevldkvspssvnwkhaskppikmpfrkvencnqvikigkqlkfslvnvagndivqgnk
klilgllwqlmrfhmlqllkslrsrtlgkemtdadilswanrkvrtmgrklqiesfkdks
lssglfflnllwaveprvvnwnlvtkgetddekrlnatyivsvarklgcsvfllpedive
vnqkmililtasimywslqr

Sequence, based on observed residues (ATOM records): (download)

>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sekgpfvqhinrylgddpflkqflpldphsnqlyelvkdgvllcklinvavpgtiderai
ntkrvlnpwernenhtlclnsakavgcsvvnigtqdlaegrphlvlglisqlikiqllad
lnlkklrlppekvllkwmnfhlkkggykktvsnfsadlkdaqayafllnvlapehcdpat
ldakdpleraelvlshaermnckryltaeeivegsstlnlafvaqifhernglndvetcr
dercyrlwinslgidsyvnnvfedvrngwillevldkvspssvnwkhaskppikmpfrkv
encnqvikigkqlkfslvnvagndivqgnkklilgllwqlmrfhmlqllkslrsemtdad
ilswanrkvrtmgrklqiesfkdkslssglfflnllwaveprvvnwnlvtkgetddekrl
natyivsvarklgcsvfllpedivevnqkmililtasimywslqr

SCOPe Domain Coordinates for d1pxya_:

Click to download the PDB-style file with coordinates for d1pxya_.
(The format of our PDB-style files is described here.)

Timeline for d1pxya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pxyb_