Lineage for d1pxua_ (1pxu A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463416Superfamily b.40.3: TIMP-like [50242] (3 families) (S)
  5. 463433Family b.40.3.2: The laminin-binding domain of agrin [63767] (1 protein)
  6. 463434Protein The laminin-binding domain of agrin [63768] (1 species)
  7. 463435Species Chicken (Gallus gallus) [TaxId:9031] [63769] (3 PDB entries)
  8. 463437Domain d1pxua_: 1pxu A: [104383]
    Fragment

Details for d1pxua_

PDB Entry: 1pxu (more details), 2.2 Å

PDB Description: Crystal structure of chicken NtA from a eukaryotic source at 2.2A resolution

SCOP Domain Sequences for d1pxua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxua_ b.40.3.2 (A:) The laminin-binding domain of agrin {Chicken (Gallus gallus)}
ncperelqrreeeanvvltgtveeimnvdpvhhtysckvrvwrylkgkdivtheilldgg
nkvviggfgdplicdnqvstgdtriffvnpapqymwpahrnelmlnsslmritlrnleev
ehcveehrkll

SCOP Domain Coordinates for d1pxua_:

Click to download the PDB-style file with coordinates for d1pxua_.
(The format of our PDB-style files is described here.)

Timeline for d1pxua_: