Lineage for d1pxua_ (1pxu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789220Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2789248Family b.40.3.2: The laminin-binding domain of agrin [63767] (1 protein)
    automatically mapped to Pfam PF03146
  6. 2789249Protein The laminin-binding domain of agrin [63768] (1 species)
  7. 2789250Species Chicken (Gallus gallus) [TaxId:9031] [63769] (4 PDB entries)
    Uniprot Q90685 # ! Fragment
  8. 2789252Domain d1pxua_: 1pxu A: [104383]

Details for d1pxua_

PDB Entry: 1pxu (more details), 2.2 Å

PDB Description: Crystal structure of chicken NtA from a eukaryotic source at 2.2A resolution
PDB Compounds: (A:) Agrin

SCOPe Domain Sequences for d1pxua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxua_ b.40.3.2 (A:) The laminin-binding domain of agrin {Chicken (Gallus gallus) [TaxId: 9031]}
ncperelqrreeeanvvltgtveeimnvdpvhhtysckvrvwrylkgkdivtheilldgg
nkvviggfgdplicdnqvstgdtriffvnpapqymwpahrnelmlnsslmritlrnleev
ehcveehrkll

SCOPe Domain Coordinates for d1pxua_:

Click to download the PDB-style file with coordinates for d1pxua_.
(The format of our PDB-style files is described here.)

Timeline for d1pxua_: