Lineage for d1px4c3 (1px4 C:13-219)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 458916Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 458917Protein beta-Galactosidase [49804] (1 species)
  7. 458918Species Escherichia coli [TaxId:562] [49805] (25 PDB entries)
  8. 458929Domain d1px4c3: 1px4 C:13-219 [104373]
    Other proteins in same PDB: d1px4a1, d1px4a2, d1px4a4, d1px4a5, d1px4b1, d1px4b2, d1px4b4, d1px4b5, d1px4c1, d1px4c2, d1px4c4, d1px4c5, d1px4d1, d1px4d2, d1px4d4, d1px4d5

Details for d1px4c3

PDB Entry: 1px4 (more details), 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a) with iptg bound

SCOP Domain Sequences for d1px4c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px4c3 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1px4c3:

Click to download the PDB-style file with coordinates for d1px4c3.
(The format of our PDB-style files is described here.)

Timeline for d1px4c3: