SCOP 1.75: Domain d1px4b1: 1px4 B:220-333

Lineage for d1px4b1 (1px4 B:220-333)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
   Uniprot P00722

8. Domain d1px4b1: 1px4 B:220-333 [104366]
   Other proteins in same PDB: d1px4a3, d1px4a4, d1px4a5, d1px4b3, d1px4b4, d1px4b5, d1px4c3, d1px4c4, d1px4c5, d1px4d3, d1px4d4, d1px4d5

Details for d1px4b1

PDB Entry: 1px4, 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a) with iptg bound

PDB Compounds: (B:) beta-galactosidase

SCOP Domain Sequences for d1px4b1:

Sequence; same for both SEQRES and ATOM records:

>d1px4b1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

Timeline for d1px4b1:

• d1px4b1 first appeared in SCOP 1.69
  
• d1px4b1 appears in SCOP 1.73
  
• d1px4b1 appears in SCOPe 2.01
  
• d1px4b1 appears in the current release, SCOPe 2.08