Lineage for d1px4a5 (1px4 A:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439329Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2439337Species Escherichia coli [TaxId:562] [51511] (45 PDB entries)
    Uniprot P00722
  8. 2439346Domain d1px4a5: 1px4 A:334-625 [104365]
    Other proteins in same PDB: d1px4a1, d1px4a2, d1px4a3, d1px4a4, d1px4b1, d1px4b2, d1px4b3, d1px4b4, d1px4c1, d1px4c2, d1px4c3, d1px4c4, d1px4d1, d1px4d2, d1px4d3, d1px4d4
    complexed with dms, ipt, mg, na

Details for d1px4a5

PDB Entry: 1px4 (more details), 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a) with iptg bound
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1px4a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px4a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1px4a5:

Click to download the PDB-style file with coordinates for d1px4a5.
(The format of our PDB-style files is described here.)

Timeline for d1px4a5: