Lineage for d1px3d2 (1px3 D:626-730)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) 
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
Uniprot P00722
Domain d1px3d2: 1px3 D:626-730 [104357]
Other proteins in same PDB: d1px3a3, d1px3a4, d1px3a5, d1px3b3, d1px3b4, d1px3b5, d1px3c3, d1px3c4, d1px3c5, d1px3d3, d1px3d4, d1px3d5
complexed with dms, mg, na
Details for d1px3d2
PDB Entry: 1px3 (more details), 1.6 Å
PDB Description: e. coli (lacz) beta-galactosidase (g794a)
PDB Compounds: (D:) beta-galactosidaseSCOPe Domain Sequences for d1px3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px3d2 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
SCOPe Domain Coordinates for d1px3d2:
Click to download the PDB-style file with coordinates for d1px3d2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1px3d2:
- d1px3d2 first appeared in SCOP 1.69
- d1px3d2 appears in SCOPe 2.07
 View in 3DDomains from same chain: (mouse over for more information) d1px3d1, d1px3d3, d1px3d4, d1px3d5 |
