![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
![]() | Domain d1px3c2: 1px3 C:626-730 [104352] Other proteins in same PDB: d1px3a3, d1px3a4, d1px3a5, d1px3b3, d1px3b4, d1px3b5, d1px3c3, d1px3c4, d1px3c5, d1px3d3, d1px3d4, d1px3d5 complexed with dms, mg, na |
PDB Entry: 1px3 (more details), 1.6 Å
SCOPe Domain Sequences for d1px3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px3c2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1px3c2:
![]() Domains from same chain: (mouse over for more information) d1px3c1, d1px3c3, d1px3c4, d1px3c5 |