![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein beta-Galactosidase, domain 3 [51510] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [51511] (46 PDB entries) Uniprot P00722 |
![]() | Domain d1px3b5: 1px3 B:334-625 [104350] Other proteins in same PDB: d1px3a1, d1px3a2, d1px3a3, d1px3a4, d1px3b1, d1px3b2, d1px3b3, d1px3b4, d1px3c1, d1px3c2, d1px3c3, d1px3c4, d1px3d1, d1px3d2, d1px3d3, d1px3d4 complexed with dms, mg, na |
PDB Entry: 1px3 (more details), 1.6 Å
SCOPe Domain Sequences for d1px3b5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px3b5 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1px3b5:
![]() Domains from same chain: (mouse over for more information) d1px3b1, d1px3b2, d1px3b3, d1px3b4 |