Lineage for d1px3b2 (1px3 B:626-730)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936216Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 936217Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 936218Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 936232Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
    Uniprot P00722
  8. 936276Domain d1px3b2: 1px3 B:626-730 [104347]
    Other proteins in same PDB: d1px3a3, d1px3a4, d1px3a5, d1px3b3, d1px3b4, d1px3b5, d1px3c3, d1px3c4, d1px3c5, d1px3d3, d1px3d4, d1px3d5
    complexed with dms, mg, na

Details for d1px3b2

PDB Entry: 1px3 (more details), 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1px3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px3b2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1px3b2:

Click to download the PDB-style file with coordinates for d1px3b2.
(The format of our PDB-style files is described here.)

Timeline for d1px3b2: