SCOP 1.73: Domain d1px3b1: 1px3 B:220-333

Lineage for d1px3b1 (1px3 B:220-333)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)

8. Domain d1px3b1: 1px3 B:220-333 [104346]
   Other proteins in same PDB: d1px3a3, d1px3a4, d1px3a5, d1px3b3, d1px3b4, d1px3b5, d1px3c3, d1px3c4, d1px3c5, d1px3d3, d1px3d4, d1px3d5

Details for d1px3b1

PDB Entry: 1px3, 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a)

PDB Compounds: (B:) beta-galactosidase

SCOP Domain Sequences for d1px3b1:

Sequence; same for both SEQRES and ATOM records:

>d1px3b1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

Timeline for d1px3b1:

• d1px3b1 first appeared in SCOP 1.69
  
• d1px3b1 appears in SCOP 1.71
  
• d1px3b1 appears in SCOP 1.75
  
• d1px3b1 appears in the current release, SCOPe 2.08