Lineage for d1px3b1 (1px3 B:220-333)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 455233Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 455234Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 455235Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 455236Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
  8. 455247Domain d1px3b1: 1px3 B:220-333 [104346]
    Other proteins in same PDB: d1px3a3, d1px3a4, d1px3a5, d1px3b3, d1px3b4, d1px3b5, d1px3c3, d1px3c4, d1px3c5, d1px3d3, d1px3d4, d1px3d5

Details for d1px3b1

PDB Entry: 1px3 (more details), 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a)

SCOP Domain Sequences for d1px3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px3b1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1px3b1:

Click to download the PDB-style file with coordinates for d1px3b1.
(The format of our PDB-style files is described here.)

Timeline for d1px3b1: