Lineage for d1px3a5 (1px3 A:334-625)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682674Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 682682Species Escherichia coli [TaxId:562] [51511] (25 PDB entries)
  8. 682723Domain d1px3a5: 1px3 A:334-625 [104345]
    Other proteins in same PDB: d1px3a1, d1px3a2, d1px3a3, d1px3a4, d1px3b1, d1px3b2, d1px3b3, d1px3b4, d1px3c1, d1px3c2, d1px3c3, d1px3c4, d1px3d1, d1px3d2, d1px3d3, d1px3d4

Details for d1px3a5

PDB Entry: 1px3 (more details), 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a)
PDB Compounds: (A:) beta-galactosidase

SCOP Domain Sequences for d1px3a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px3a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1px3a5:

Click to download the PDB-style file with coordinates for d1px3a5.
(The format of our PDB-style files is described here.)

Timeline for d1px3a5: