Lineage for d1px3a4 (1px3 A:731-1023)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 460730Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 460800Superfamily b.30.5: Galactose mutarotase-like [74650] (10 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 460801Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 460802Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 460803Species Escherichia coli [TaxId:562] [49997] (25 PDB entries)
  8. 460808Domain d1px3a4: 1px3 A:731-1023 [104344]
    Other proteins in same PDB: d1px3a1, d1px3a2, d1px3a3, d1px3a5, d1px3b1, d1px3b2, d1px3b3, d1px3b5, d1px3c1, d1px3c2, d1px3c3, d1px3c5, d1px3d1, d1px3d2, d1px3d3, d1px3d5

Details for d1px3a4

PDB Entry: 1px3 (more details), 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a)

SCOP Domain Sequences for d1px3a4:

Sequence, based on SEQRES records: (download)

>d1px3a4 b.30.5.1 (A:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

Sequence, based on observed residues (ATOM records): (download)

>d1px3a4 b.30.5.1 (A:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndiavsearidpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfi
srktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlt
aacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmets
hrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1px3a4:

Click to download the PDB-style file with coordinates for d1px3a4.
(The format of our PDB-style files is described here.)

Timeline for d1px3a4: