Lineage for d1pwca_ (1pwc A:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517216Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 517217Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 517218Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)
  6. 517461Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 517470Species Streptomyces sp., R61 [TaxId:1931] [56605] (13 PDB entries)
  8. 517474Domain d1pwca_: 1pwc A: [104338]

Details for d1pwca_

PDB Entry: 1pwc (more details), 1.1 Å

PDB Description: penicilloyl acyl enzyme complex of the Streptomyces R61 DD-peptidase with penicillin G

SCOP Domain Sequences for d1pwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwca_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61}
lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

SCOP Domain Coordinates for d1pwca_:

Click to download the PDB-style file with coordinates for d1pwca_.
(The format of our PDB-style files is described here.)

Timeline for d1pwca_: