Lineage for d1pw3b_ (1pw3 B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 452262Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 452266Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88535] (4 PDB entries)
  8. 452272Domain d1pw3b_: 1pw3 B: [104336]

Details for d1pw3b_

PDB Entry: 1pw3 (more details), 1.9 Å

PDB Description: crystal structure of jtor68s

SCOP Domain Sequences for d1pw3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pw3b_ b.1.1.1 (B:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1}
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidsssnsasltisglktedeadyycqsydarnvvfgggtrltvlg

SCOP Domain Coordinates for d1pw3b_:

Click to download the PDB-style file with coordinates for d1pw3b_.
(The format of our PDB-style files is described here.)

Timeline for d1pw3b_: