SCOP 1.69: Domain d1pw1a_: 1pw1 A:

Lineage for d1pw1a_ (1pw1 A:)

1. Root: SCOP 1.69

2. Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)

6. Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)

7. Species Streptomyces sp., R61 [TaxId:1931] [56605] (13 PDB entries)

8. Domain d1pw1a_: 1pw1 A: [104334]

Details for d1pw1a_

PDB Entry: 1pw1, 1.2 Å

PDB Description: non-covalent complex of streptomyces r61 dd-peptidase with a highly specific penicillin

SCOP Domain Sequences for d1pw1a_:

Sequence; same for both SEQRES and ATOM records:

>d1pw1a_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61}
lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

Timeline for d1pw1a_:

• d1pw1a_ is new in SCOP 1.69
  
• d1pw1a_ appears in SCOP 1.71
  
• d1pw1a_ appears in the current release, SCOPe 2.08