SCOPe 2.08: Domain d1pvsb1: 1pvs B:100-282

Lineage for d1pvsb1 (1pvs B:100-282)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)

7. Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
   Uniprot P04395

8. Domain d1pvsb1: 1pvs B:100-282 [104331]
   Other proteins in same PDB: d1pvsa2, d1pvsb2
   protein/DNA complex; complexed with 7hp

Details for d1pvsb1

PDB Entry: 1pvs, 2.4 Å

PDB Description: 3-methyladenine Glcosylase II(AlkA) Hypoxanthine complex

PDB Compounds: (B:) DNA-3-methyladenine glycosylase II

SCOPe Domain Sequences for d1pvsb1:

Sequence; same for both SEQRES and ATOM records:

>d1pvsb1 a.96.1.3 (B:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

Timeline for d1pvsb1:

• d1pvsb1 first appeared in SCOP 1.69
  
• d1pvsb1 appears in SCOPe 2.07