Class a: All alpha proteins [46456] (290 folds) |
Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) |
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins) |
Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species) |
Species Escherichia coli [TaxId:562] [48159] (11 PDB entries) Uniprot P04395 |
Domain d1pvsb1: 1pvs B:100-282 [104331] Other proteins in same PDB: d1pvsa2, d1pvsb2 protein/DNA complex; complexed with 7hp |
PDB Entry: 1pvs (more details), 2.4 Å
SCOPe Domain Sequences for d1pvsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvsb1 a.96.1.3 (B:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp dea
Timeline for d1pvsb1: