Lineage for d1pvsa1 (1pvs A:100-282)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006171Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2006172Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2006213Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2006214Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 2006215Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
    Uniprot P04395
  8. 2006226Domain d1pvsa1: 1pvs A:100-282 [104329]
    Other proteins in same PDB: d1pvsa2, d1pvsb2
    protein/DNA complex; complexed with 7hp

Details for d1pvsa1

PDB Entry: 1pvs (more details), 2.4 Å

PDB Description: 3-methyladenine Glcosylase II(AlkA) Hypoxanthine complex
PDB Compounds: (A:) DNA-3-methyladenine glycosylase II

SCOPe Domain Sequences for d1pvsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvsa1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

SCOPe Domain Coordinates for d1pvsa1:

Click to download the PDB-style file with coordinates for d1pvsa1.
(The format of our PDB-style files is described here.)

Timeline for d1pvsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pvsa2