Lineage for d1pvjb_ (1pvj B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154906Protein Streptococcal pyrogenic exotoxin B [54035] (1 species)
  7. 2154907Species Streptococcus pyogenes [TaxId:1314] [54036] (2 PDB entries)
    Uniprot P00788 31-398
  8. 2154913Domain d1pvjb_: 1pvj B: [104326]
    complexed with zfb

Details for d1pvjb_

PDB Entry: 1pvj (more details), 3 Å

PDB Description: crystal structure of the streptococcal pyrogenic exotoxin b (speb)- inhibitor complex
PDB Compounds: (B:) pyrogenic exotoxin B

SCOPe Domain Sequences for d1pvjb_:

Sequence, based on SEQRES records: (download)

>d1pvjb_ d.3.1.1 (B:) Streptococcal pyrogenic exotoxin B {Streptococcus pyogenes [TaxId: 1314]}
farnekeakdsaitfiqksaaikagarsaedikldkvnlggelsgsnmyvynistggfvi
vsgdkrspeilgystsgsfdangkeniasfmesyveqikenkkldttyagtaeikqpvvk
slldskgihynqgnpynlltpviekvkpgeqsfvgqhaatgcvatataqimkyhnypnkg
lkdytytlssnnpyfnhpknlfaaistrqynwnnilptysgresnvqkmaiselmadvgi
svdmdygpssgsagssrvqralkenfgynqsvhqinrgdfskqdweaqidkelsqnqpvy
yqgvgkvgghafvidgadgrnfyhvnwgwggvsdgffrldalnpsalgtgggadgfngyq
savvgikp

Sequence, based on observed residues (ATOM records): (download)

>d1pvjb_ d.3.1.1 (B:) Streptococcal pyrogenic exotoxin B {Streptococcus pyogenes [TaxId: 1314]}
farnekeakdsaitfiqkikldkvnlggelsgsnmyvynistggfvivsgdkrspeilgy
stsgsfdangkeniasfmesyveqikenkkldttyaqpvvkslldskgihynqgnpynll
tpviekvkpgeqsfvgqhaatgcvatataqimkyhnypnkglkdytytlssnnpyfnhpk
nlfaaistrqynwnnilptysgresnvqkmaiselmadvgisvdmdygpssgsagssrvq
ralkenfgynqsvhqinrgdfskqdweaqidkelsqnqpvyyqgvgkvgghafvidgadg
rnfyhvnwgwggvsdgffrldalnpgfngyqsavvgikp

SCOPe Domain Coordinates for d1pvjb_:

Click to download the PDB-style file with coordinates for d1pvjb_.
(The format of our PDB-style files is described here.)

Timeline for d1pvjb_: