Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) |
Protein Isopentenyl diphosphate isomerase [64370] (2 species) |
Species Escherichia coli [TaxId:562] [64371] (18 PDB entries) Uniprot Q46822 |
Domain d1pvfb1: 1pvf B:4-182 [104324] Other proteins in same PDB: d1pvfb2 complexed with dpo, mg, mn |
PDB Entry: 1pvf (more details), 1.78 Å
SCOPe Domain Sequences for d1pvfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvfb1 d.113.1.2 (B:4-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk
Timeline for d1pvfb1: