Lineage for d1pvea1 (1pve A:5-72)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014464Fold a.189: XPC-binding domain [101237] (1 superfamily)
    4 helices; array
  4. 2014465Superfamily a.189.1: XPC-binding domain [101238] (2 families) (S)
  5. 2014466Family a.189.1.1: XPC-binding domain [101239] (4 protein domains)
  6. 2014475Protein XPC-binding domain of Rad23 homolog B (Hhr23b) [109851] (1 species)
  7. 2014476Species Human (Homo sapiens) [TaxId:9606] [109852] (1 PDB entry)
    Uniprot P54727 275-342 # structure of the N-terminal domain (1-87) is also known (102778)
  8. 2014477Domain d1pvea1: 1pve A:5-72 [104322]
    Other proteins in same PDB: d1pvea2

Details for d1pvea1

PDB Entry: 1pve (more details)

PDB Description: Solution structure of XPC binding domain of hHR23B
PDB Compounds: (A:) UV excision repair protein RAD23 homolog B

SCOPe Domain Sequences for d1pvea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvea1 a.189.1.1 (A:5-72) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]}
pleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepvqe
aggqgggg

SCOPe Domain Coordinates for d1pvea1:

Click to download the PDB-style file with coordinates for d1pvea1.
(The format of our PDB-style files is described here.)

Timeline for d1pvea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pvea2