SCOPe 2.08: Domain d1pvea1: 1pve A:5-72

Lineage for d1pvea1 (1pve A:5-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.189: XPC-binding domain-like [101237] (1 superfamily)
   4 helices; array

4. Superfamily a.189.1: XPC-binding domain [101238] (2 families)

5. Family a.189.1.1: XPC-binding domain [101239] (4 proteins)

6. Protein XPC-binding domain of Rad23 homolog B (Hhr23b) [109851] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109852] (1 PDB entry)
   Uniprot P54727 275-342 # structure of the N-terminal domain (1-87) is also known (102778)

8. Domain d1pvea1: 1pve A:5-72 [104322]
   Other proteins in same PDB: d1pvea2

Details for d1pvea1

PDB Entry: 1pve

PDB Description: solution structure of xpc binding domain of hhr23b

PDB Compounds: (A:) UV excision repair protein RAD23 homolog B

SCOPe Domain Sequences for d1pvea1:

Sequence; same for both SEQRES and ATOM records:

>d1pvea1 a.189.1.1 (A:5-72) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]}
pleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepvqe
aggqgggg

Timeline for d1pvea1:

• d1pvea1 first appeared in SCOP 1.69, called d1pvea_
  
• d1pvea1 appears in SCOPe 2.07