Lineage for d1pv3a_ (1pv3 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638269Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (1 family) (S)
  5. 638270Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (1 protein)
  6. 638271Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 638272Species Chicken (Gallus gallus) [TaxId:9031] [81735] (3 PDB entries)
  8. 638274Domain d1pv3a_: 1pv3 A: [104321]

Details for d1pv3a_

PDB Entry: 1pv3 (more details)

PDB Description: nmr solution structure of the avian fat-domain of focal adhesion kinase
PDB Compounds: (A:) Focal adhesion kinase 1

SCOP Domain Sequences for d1pv3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv3a_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Chicken (Gallus gallus) [TaxId: 9031]}
gspgisgggggirsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtlla
tvdeslpvlpasthreiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaaha
lavdaknlldvidqarlkmisqsrph

SCOP Domain Coordinates for d1pv3a_:

Click to download the PDB-style file with coordinates for d1pv3a_.
(The format of our PDB-style files is described here.)

Timeline for d1pv3a_: