![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.218: YgfY-like [109909] (1 superfamily) 5 helices; array; forms a tight dimer in crystals |
![]() | Superfamily a.218.1: YgfY-like [109910] (1 family) ![]() |
![]() | Family a.218.1.1: YgfY-like [109911] (1 protein) Pfam 03937; despite the Pfam annotation, this family shows no topological similarity to the TPR repeat proteins |
![]() | Protein Hypothetical protein NMA1147 [109912] (1 species) |
![]() | Species Neisseria meningitidis, mc58 [TaxId:487] [109913] (1 PDB entry) |
![]() | Domain d1puza_: 1puz A: [104320] Structural genomics target |
PDB Entry: 1puz (more details)
SCOP Domain Sequences for d1puza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1puza_ a.218.1.1 (A:) Hypothetical protein NMA1147 {Neisseria meningitidis, mc58} mmvfddiakrkirfqtrrglleldlifgrfmekefehlsdkelsefseilefqdqellal inghsetdkghlipmlekirra
Timeline for d1puza_: