SCOP 1.71: Domain d1puza_: 1puz A:

Lineage for d1puza_ (1puz A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.218: YgfY-like [109909] (1 superfamily)
   5 helices; array; forms a tight dimer in crystals

4. Superfamily a.218.1: YgfY-like [109910] (1 family)

5. Family a.218.1.1: YgfY-like [109911] (1 protein)
   Pfam 03937; despite the Pfam annotation, this family shows no topological similarity to the TPR repeat proteins

6. Protein Hypothetical protein NMA1147 [109912] (1 species)

7. Species Neisseria meningitidis, mc58 [TaxId:487] [109913] (1 PDB entry)

8. Domain d1puza_: 1puz A: [104320]
   Structural genomics target

Details for d1puza_

PDB Entry: 1puz

PDB Description: Solution NMR Structure of Protein NMA1147 from Neisseria meningitidis. Northeast Structural Genomics Consortium Target MR19

SCOP Domain Sequences for d1puza_:

Sequence; same for both SEQRES and ATOM records:

>d1puza_ a.218.1.1 (A:) Hypothetical protein NMA1147 {Neisseria meningitidis, mc58}
mmvfddiakrkirfqtrrglleldlifgrfmekefehlsdkelsefseilefqdqellal
inghsetdkghlipmlekirra

Timeline for d1puza_:

• d1puza_ first appeared in SCOP 1.69
  
• d1puza_ appears in SCOP 1.73
  
• d1puza_ appears in the current release, SCOPe 2.08