Lineage for d1puza_ (1puz A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.218: YgfY-like [109909] (1 superfamily)
    5 helices; array; forms a tight dimer in crystals
  4. Superfamily a.218.1: YgfY-like [109910] (2 families) (S)
  5. Family a.218.1.1: YgfY-like [109911] (1 protein)
    Pfam PF03937; despite the Pfam annotation, this family shows no topological similarity to the TPR repeat proteins
  6. Protein Hypothetical protein NMA1147 [109912] (1 species)
  7. Species Neisseria meningitidis, mc58 [TaxId:487] [109913] (1 PDB entry)
    Uniprot Q9JR91
  8. Domain d1puza_: 1puz A: [104320]
    Structural genomics target

Details for d1puza_

PDB Entry: 1puz (more details)

PDB Description: Solution NMR Structure of Protein NMA1147 from Neisseria meningitidis. Northeast Structural Genomics Consortium Target MR19
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1puza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puza_ a.218.1.1 (A:) Hypothetical protein NMA1147 {Neisseria meningitidis, mc58 [TaxId: 487]}
mmvfddiakrkirfqtrrglleldlifgrfmekefehlsdkelsefseilefqdqellal
inghsetdkghlipmlekirra

SCOPe Domain Coordinates for d1puza_ are not available.

Timeline for d1puza_: