Lineage for d1puza_ (1puz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015573Fold a.218: YgfY-like [109909] (1 superfamily)
    5 helices; array; forms a tight dimer in crystals
  4. 2015574Superfamily a.218.1: YgfY-like [109910] (2 families) (S)
  5. 2015575Family a.218.1.1: YgfY-like [109911] (1 protein)
    Pfam PF03937; despite the Pfam annotation, this family shows no topological similarity to the TPR repeat proteins
  6. 2015576Protein Hypothetical protein NMA1147 [109912] (1 species)
  7. 2015577Species Neisseria meningitidis, mc58 [TaxId:487] [109913] (1 PDB entry)
    Uniprot Q9JR91
  8. 2015578Domain d1puza_: 1puz A: [104320]
    Structural genomics target

Details for d1puza_

PDB Entry: 1puz (more details)

PDB Description: Solution NMR Structure of Protein NMA1147 from Neisseria meningitidis. Northeast Structural Genomics Consortium Target MR19
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1puza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puza_ a.218.1.1 (A:) Hypothetical protein NMA1147 {Neisseria meningitidis, mc58 [TaxId: 487]}
mmvfddiakrkirfqtrrglleldlifgrfmekefehlsdkelsefseilefqdqellal
inghsetdkghlipmlekirra

SCOPe Domain Coordinates for d1puza_:

Click to download the PDB-style file with coordinates for d1puza_.
(The format of our PDB-style files is described here.)

Timeline for d1puza_: