Lineage for d1puub2 (1puu B:385-507)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800749Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 800938Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 800939Family b.42.2.1: Ricin B-like [50371] (10 proteins)
  6. 800998Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 801009Species European mistletoe (Viscum album) [TaxId:3972] [50375] (14 PDB entries)
    different sequence variants
    Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity
  8. 801021Domain d1puub2: 1puu B:385-507 [104319]
    Other proteins in same PDB: d1puua_
    complexed with cl, dox, fuc, gol, lat, nag, so4

Details for d1puub2

PDB Entry: 1puu (more details), 2.3 Å

PDB Description: mistletoe lectin i in complex with lactose
PDB Compounds: (B:) lectin I B chain

SCOP Domain Sequences for d1puub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puub2 b.42.2.1 (B:385-507) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
aprettiygfrdlcmesnggsvwvetctagqenqrwalygdgsirpkqnqsqcltngrds
vstvinivscsagssgqrwvftnagailnlknglamdvaqanpalsriiiypatgnpnqm
wlpvp

SCOP Domain Coordinates for d1puub2:

Click to download the PDB-style file with coordinates for d1puub2.
(The format of our PDB-style files is described here.)

Timeline for d1puub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1puub1
View in 3D
Domains from other chains:
(mouse over for more information)
d1puua_