SCOP 1.69: Domain d1puub2: 1puu B:385-507

Lineage for d1puub2 (1puu B:385-507)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (2 families)

5. Family b.42.2.1: Ricin B-like [50371] (6 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (9 PDB entries)
   different sequence variants

8. Domain d1puub2: 1puu B:385-507 [104319]
   Other proteins in same PDB: d1puua_

Details for d1puub2

PDB Entry: 1puu, 2.3 Å

PDB Description: mistletoe lectin i in complex with lactose

SCOP Domain Sequences for d1puub2:

Sequence; same for both SEQRES and ATOM records:

>d1puub2 b.42.2.1 (B:385-507) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)}
aprettiygfrdlcmesnggsvwvetctagqenqrwalygdgsirpkqnqsqcltngrds
vstvinivscsagssgqrwvftnagailnlknglamdvaqanpalsriiiypatgnpnqm
wlpvp

Timeline for d1puub2:

• d1puub2 is new in SCOP 1.69
  
• d1puub2 appears in SCOP 1.71
  
• d1puub2 last appears in SCOPe 2.02