Lineage for d1puub1 (1puu B:248-384)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669060Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 669245Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 669246Family b.42.2.1: Ricin B-like [50371] (7 proteins)
  6. 669271Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 669282Species European mistletoe (Viscum album) [TaxId:3972] [50375] (11 PDB entries)
    different sequence variants
  8. 669289Domain d1puub1: 1puu B:248-384 [104318]
    Other proteins in same PDB: d1puua_

Details for d1puub1

PDB Entry: 1puu (more details), 2.3 Å

PDB Description: mistletoe lectin i in complex with lactose
PDB Compounds: (B:) lectin I B chain

SCOP Domain Sequences for d1puub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puub1 b.42.2.1 (B:248-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
dvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirsn
gsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttltv
qtldytlgqgwlagndt

SCOP Domain Coordinates for d1puub1:

Click to download the PDB-style file with coordinates for d1puub1.
(The format of our PDB-style files is described here.)

Timeline for d1puub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1puub2
View in 3D
Domains from other chains:
(mouse over for more information)
d1puua_