Lineage for d1puua_ (1puu A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737398Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 737399Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 737400Family d.165.1.1: Plant cytotoxins [56372] (15 proteins)
  6. 737463Protein Mistletoe lectin I A-chain [56381] (1 species)
  7. 737464Species European mistletoe (Viscum album) [TaxId:3972] [56382] (11 PDB entries)
    different sequence variants
  8. 737468Domain d1puua_: 1puu A: [104317]
    Other proteins in same PDB: d1puub1, d1puub2
    complexed with cl, dox, fuc, gol, lat, nag, so4

Details for d1puua_

PDB Entry: 1puu (more details), 2.3 Å

PDB Description: mistletoe lectin i in complex with lactose
PDB Compounds: (A:) lectin I A chain

SCOP Domain Sequences for d1puua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puua_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]}
yerlslrtvqqttgaeyfsfitllrdfvssgsfsnnipllrqstipvsegsrfvlveltn
aggdsitaaidvtnlyvvayqagqqsyflkdapagaetqdfagttrsslpfngsypdler
yaghrdqiplgidqliasvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpialalppgnvvtltnirdviasl
aimlfvcge

SCOP Domain Coordinates for d1puua_:

Click to download the PDB-style file with coordinates for d1puua_.
(The format of our PDB-style files is described here.)

Timeline for d1puua_: